ISCA2 Antibody - middle region (ARP53448_P050)

• Product Number: ARP53448_P050
• Name: ISCA2 Antibody - middle region (ARP53448_P050)
• Protein Size (# AA): 154 amino acids
• Molecular Weight: 16 kDa
• NCBI Gene Id: 122961
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Iron-sulfur cluster assembly 2 homolog (S. cerevisiae)
• Alias Symbols: ISA2, HBLD1, MMDS4, c14_5557
• Peptide Sequence: Synthetic peptide located within the following region: RREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
• Description of Target: ISCA2 is involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.
• Protein Interactions: RNF41;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-ISCA2 (ARP53448_P050) antibody is Catalog # AAP53448 (Previous Catalog # AAPP31971)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ISCA2
• Uniprot ID: Q86U28
• Protein Name: Iron-sulfur cluster assembly 2 homolog, mitochondrial
• Protein Accession #: NP_919255
• Purification: Affinity Purified
• Nucleotide Accession #: NM_194279
• Tested Species Reactivity: Human
• Gene Symbol: ISCA2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 79%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
• Image 1: Human Thymus
  
  WB Suggested Anti-ISCA2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Human Thymus