LRRC50 Antibody - N-terminal region (ARP53358_P050)

Data Sheet
 
Product Number ARP53358_P050
Product Page www.avivasysbio.com/lrrc50-antibody-n-terminal-region-arp53358-p050.html
Name LRRC50 Antibody - N-terminal region (ARP53358_P050)
Protein Size (# AA) 725 amino acids
Molecular Weight 80kDa
NCBI Gene Id 123872
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Dynein, axonemal, assembly factor 1
Alias Symbols swt, DAU1, ODA7, CILD13, LRRC50
Peptide Sequence Synthetic peptide located within the following region: LNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kimura,K., (2006) Genome Res. 16 (1), 55-65
Description of Target LRRC50 contains 6 LRR (leucine-rich) repeats. It is proposed that LRRC50 to be a novel candidate gene for human cystic kidney disease, involved in regulation of microtubule-based cilia and actin-based brush border microvilli.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DNAAF1 (ARP53358_P050) antibody
Blocking Peptide For anti-DNAAF1 (ARP53358_P050) antibody is Catalog # AAP53358 (Previous Catalog # AAPP30941)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC50
Uniprot ID Q8NEP3
Protein Name Dynein assembly factor 1, axonemal
Publications

Yang, L. et al. Knockdown of PPAR d gene promotes the growth of colon cancer and reduces the sensitivity to bevacizumab in nude mice model. PLoS One 8, e60715 (2013). 23593291

Sample Type Confirmation

DNAAF1 is supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_848547
Purification Affinity Purified
Nucleotide Accession # NM_178452
Tested Species Reactivity Human
Gene Symbol DNAAF1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Image 1
Human 721_B
Host: Rabbit
Target Name: DNAAF1
Sample Type: Human 721_B
Antibody Dilution: 1.0ug/mlDNAAF1 is supported by BioGPS gene expression data to be expressed in 721_B
Image 2
Human Fetal Muscle
Host: Rabbit
Target Name: DNAAF1
Sample Type: Human Fetal Muscle
Antibody Dilution: 1.0ug/ml
Image 3
Human Fetal Lung
Host: Rabbit
Target Name: DNAAF1
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml
Image 4
Human HepG2
WB Suggested Anti-LRRC50 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com