RETREG3 Antibody - N-terminal region (ARP53354_P050)

• Name: RETREG3 Antibody - N-terminal region (ARP53354_P050)
• Protein Size (# AA): 466 amino acids
• Molecular Weight: 51kDa
• NCBI Gene Id: 162427
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: reticulophagy regulator family member 3
• Alias Symbols: FAM134C
• Peptide Sequence: Synthetic peptide located within the following region: EAAQRALVEVLGPYEPLLSRVQAALVWERPARSALWCLGLNAAFWFFALT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Rommens,J.M., (1995) Genomics 28 (3), 530-542
• Protein Interactions: MAP1LC3A; STAP1; GABARAPL1; ARL6IP1; ABHD16A; ELAVL1; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RETREG3 (ARP53354_P050) antibody is Catalog # AAP53354 (Previous Catalog # AAPP30937)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM134C
• Uniprot ID: Q86VR2
• Protein Name: reticulophagy regulator 3
• Sample Type Confirmation:

  FAM134C is supported by BioGPS gene expression data to be expressed in 721_B

• Protein Accession #: NP_835227
• Purification: Affinity Purified
• Nucleotide Accession #: NM_178126
• Tested Species Reactivity: Human
• Gene Symbol: RETREG3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
• Image 1: Human 721_B
  
  WB Suggested Anti-FAM134C Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: 721_B cell lysateFAM134C is supported by BioGPS gene expression data to be expressed in 721_B