FUNDC1 Antibody - N-terminal region (ARP53280_P050)

• Product Number: ARP53280_P050
• Name: FUNDC1 Antibody - N-terminal region (ARP53280_P050)
• Protein Size (# AA): 155 amino acids
• Molecular Weight: 17 kDa
• NCBI Gene Id: 139341
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: FUN14 domain containing 1
• Description:
  View product citations for FUNDC1 Antibody - N-terminal region (ARP53280_P050) on CiteAb
• Alias Symbols: MGC51029
• Peptide Sequence: Synthetic peptide located within the following region: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ross,M.T., (2005) Nature 434 (7031), 325-337
• Description of Target: FUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown.
• Protein Interactions: SLC25A46; MAP1LC3A; MAP1LC3B; SENP2; SH3GLB1; MTERF3; GABARAPL1; GABARAPL2; YES1; TUFM; SNX1; EHHADH; CTBP2; CTBP1; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-FUNDC1 (ARP53280_P050) antibody is Catalog # AAP53280 (Previous Catalog # AAPP30762)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FUNDC1
• Uniprot ID: Q8IVP5
• Protein Name: FUN14 domain-containing protein 1
• Publications:

  BNIP3L/Nix-induced mitochondrial fission, mitophagy, and impaired myocyte glucose uptake are abrogated by PRKA/PKA phosphorylation. Autophagy. , 42370 (2020). 33044904

  FUNDC1 regulates mitochondrial dynamics at the ER-mitochondrial contact site under hypoxic conditions. EMBO J. 35, 1368-84 (2016). 27145933

  Huang, M. L.-H. et al. Molecular and functional alterations in a mouse cardiac model of Friedreich ataxia: activation of the integrated stress response, eIF2a phosphorylation, and the induction of downstream targets. Am. J. Pathol. 183, 745-57 (2013). 23886890

  Mark A Lampert, et al. BNIP3L/NIX and FUNDC1-mediated mitophagy is required for mitochondrial network remodeling during cardiac progenitor cell differentiation. 1182-1198 (2019). 30741592

  MicroRNA-137 is a novel hypoxia-responsive microRNA that inhibits mitophagy via regulation of two mitophagy receptors FUNDC1 and NIX. J Biol Chem. 289, 10691-701 (2014). 24573672

  Phosphorylation of ULK1 by AMPK regulates translocation of ULK1 to mitochondria and mitophagy. FEBS Lett. 589, 1847-54 (2015). 25980607

  Spermidine preconditioning ameliorates laurate-induced brain injury by maintaining mitochondrial stability. Neurol. Res. 39, 248-258 (2017). 28112032

  Structural basis for the phosphorylation of FUNDC1 LIR as a molecular switch of mitophagy. Autophagy. 12, 2363-2373 (2016). 27653272

  STX17 dynamically regulated by Fis1 induces mitophagy via hierarchical macroautophagic mechanism. Nat Commun. 10, 2059 (2019). 31053718

• Protein Accession #: NP_776155
• Purification: Affinity Purified
• Nucleotide Accession #: NM_173794
• Tested Species Reactivity: Human
• Gene Symbol: FUNDC1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB, IP
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Heart
  
  WB Suggested Anti-FUNDC1 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human heart
• Image 2: HEK293 Whole Cell Lysate
  
  FUNDC1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with ARP53280_P050 with 1:200 dilution. Western blot was performed using ARP53280_P050 at 1/1000 dilution.
  Lane 1: Control IP in HEK293 Whole Cell Lysate.
  Lane 2: FUNDC1 IP with ARP53280_P050 in HEK293 Whole Cell Lysate.
  Lane 3: Input of HEK293 Whole Cell Lysate.
• Image 3: Stomach tumor, Human lung
  
  Host: Rabbit
  Target: FUNDC1
  Positive control (+): Stomach tumor (T-ST)
  Negative control (-): Human lung (LU)
  Antibody concentration: 3ug/ml