DCUN1D3 Antibody - C-terminal region (ARP53231_P050)

• Name: DCUN1D3 Antibody - C-terminal region (ARP53231_P050)
• Protein Size (# AA): 304 amino acids
• Molecular Weight: 34kDa
• NCBI Gene Id: 123879
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae)
• Alias Symbols: DCNL3, 44M2.4, SCCRO3
• Peptide Sequence: Synthetic peptide located within the following region: LNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kurz,T., (2005) Nature 435 (7046), 1257-1261
• Description of Target: DCUN1D3 contains 1 DCUN1 domain. The exact function of DCUN1D3 remains unknown.
• Protein Interactions: RBX1; UBE2M; CUL1; CUL2; CUL3; NEDD8; UBE2F; CUL4A; CUL4B; CUL5; ELAVL1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-DCUN1D3 (ARP53231_P050) antibody is Catalog # AAP53231 (Previous Catalog # AAPP30715)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DCUN1D3
• Uniprot ID: Q8IWE4
• Protein Name: DCN1-like protein 3
• Protein Accession #: NP_775746
• Purification: Affinity Purified
• Nucleotide Accession #: NM_173475
• Tested Species Reactivity: Human
• Gene Symbol: DCUN1D3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Image 1: Human Brain
  
  WB Suggested Anti-DCUN1D3 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human brain