| Product Number |
ARP53192_P050 |
| Product Page |
www.avivasysbio.com/c12orf53-antibody-middle-region-arp53192-p050.html |
| Name |
C12orf53 Antibody - middle region (ARP53192_P050) |
| Protein Size (# AA) |
282 amino acids |
| Molecular Weight |
30kDa |
| NCBI Gene Id |
196500 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Chromosome 12 open reading frame 53 |
| Alias Symbols |
PANP, LEDA1, leda-1, C12orf53 |
| Peptide Sequence |
Synthetic peptide located within the following region: VWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSDSMRGDGDGLI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270 |
| Description of Target |
The specific function of the protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PIANP (ARP53192_P050) antibody |
| Blocking Peptide |
For anti-PIANP (ARP53192_P050) antibody is Catalog # AAP53192 (Previous Catalog # AAPP36329) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human C12orf53 |
| Uniprot ID |
Q8IYJ0 |
| Protein Name |
PILR alpha-associated neural protein |
| Protein Accession # |
NP_710152 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_153685 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PIANP |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Spleen
 | WB Suggested Anti-C12orf53 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Spleen |
|
|
