| Product Number |
ARP53177_P050 |
| Product Page |
www.avivasysbio.com/prss35-antibody-middle-region-arp53177-p050.html |
| Name |
Prss35 Antibody - middle region (ARP53177_P050) |
| Protein Size (# AA) |
409 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
244954 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
P3D9, 6030424L22Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: HDGKDYVKGSKKLRVGVLKMRNKGGRKKRRGSKRSRREAESAGQSQAHLR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Prss35 (ARP53177_P050) antibody |
| Blocking Peptide |
For anti-Prss35 (ARP53177_P050) antibody is Catalog # AAP53177 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Mouse Prss35 |
| Uniprot ID |
Q8C0F9 |
| Protein Name |
Inactive serine protease 35 |
| Protein Accession # |
NP_848853 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_178738 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Prss35 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Mouse Lung
 | Host: Rabbit
Target Name: Prss35
Sample Type: Mouse Lung lysates
Antibody Dilution: 1.0ug/ml |
|
|
