| Product Number |
ARP53176_P050-HRP |
| Product Page |
www.avivasysbio.com/prss35-antibody-n-terminal-region-hrp-arp53176-p050-hrp.html |
| Name |
PRSS35 Antibody - N-terminal region : HRP (ARP53176_P050-HRP) |
| Protein Size (# AA) |
413 amino acids |
| Molecular Weight |
47kDa |
| Conjugation |
HRP: Horseradish Peroxidase |
| NCBI Gene Id |
167681 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Protease, serine, 35 |
| Alias Symbols |
C6orf158, dJ223E3.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: PTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLTNFPFSTAVKLSTGCSG |
| Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Reference |
Miyakoshi,K., (2006) Biol. Reprod. 75 (6), 823-835 |
| Description of Target |
The specific function of this protein remains unknown. |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-PRSS35 (ARP53176_P050-HRP) antibody |
| Blocking Peptide |
For anti-PRSS35 (ARP53176_P050-HRP) antibody is Catalog # AAP53176 (Previous Catalog # AAPP36246) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PRSS35 |
| Uniprot ID |
Q8N3Z0 |
| Protein Name |
Inactive serine protease 35 |
| Protein Accession # |
NP_699193 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_153362 |
| Gene Symbol |
PRSS35 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77% |
| Image 1 | |
|
