| Product Number |
ARP53147_P050 |
| Product Page |
www.avivasysbio.com/lix1-antibody-n-terminal-region-arp53147-p050.html |
| Name |
LIX1 Antibody - N-terminal region (ARP53147_P050) |
| Protein Size (# AA) |
282 amino acids |
| Molecular Weight |
32kDa |
| NCBI Gene Id |
167410 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Lix1 homolog (chicken) |
| Alias Symbols |
Lft, C5orf11 |
| Peptide Sequence |
Synthetic peptide located within the following region: TLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMES |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Moeller,C., Brain Res. Gene Expr. Patterns 1 (3-4), 199-203 (2002) |
| Description of Target |
The specific function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LIX1 (ARP53147_P050) antibody |
| Blocking Peptide |
For anti-LIX1 (ARP53147_P050) antibody is Catalog # AAP53147 (Previous Catalog # AAPP36215) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LIX1 |
| Uniprot ID |
Q8N485 |
| Protein Name |
Protein limb expression 1 homolog |
| Protein Accession # |
NP_694966 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_153234 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LIX1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-LIX1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
|
