| Product Number |
ARP53117_P050 |
| Product Page |
www.avivasysbio.com/pdik1l-antibody-middle-region-arp53117-p050.html |
| Name |
PDIK1L Antibody - middle region (ARP53117_P050) |
| Protein Size (# AA) |
341 amino acids |
| Molecular Weight |
38kDa |
| NCBI Gene Id |
149420 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
PDLIM1 interacting kinase 1 like |
| Alias Symbols |
CLIK1L, STK35L2 |
| Peptide Sequence |
Synthetic peptide located within the following region: TSDLEPTLKVADFGLSKVCSASGQNPEEPVSVNKCFLSTACGTDFYMAPE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gregory,S.G., (2006) Nature 441 (7091), 315-321 |
| Description of Target |
The specific function of PDIK1L is not yet known. |
| Protein Interactions |
C1orf174; HSP90AA1; UBC; TNF; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PDIK1L (ARP53117_P050) antibody |
| Blocking Peptide |
For anti-PDIK1L (ARP53117_P050) antibody is Catalog # AAP53117 (Previous Catalog # AAPP35347) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PDIK1L |
| Uniprot ID |
Q8N165 |
| Protein Name |
Serine/threonine-protein kinase PDIK1L |
| Protein Accession # |
NP_690048 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152835 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PDIK1L |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Human MCF-7
 | WB Suggested Anti-PDIK1L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate |
|
|
