| Product Number |
ARP53113_P050 |
| Product Page |
www.avivasysbio.com/sasp-antibody-middle-region-arp53113-p050.html |
| Name |
SASP Antibody - middle region (ARP53113_P050) |
| Protein Size (# AA) |
343 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
151516 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Aspartic peptidase, retroviral-like 1 |
| Alias Symbols |
ADLI, MUNO, SASP, Taps, SASPase |
| Peptide Sequence |
Synthetic peptide located within the following region: RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Rhiemeier,V., (2006) Am. J. Pathol. 168 (4), 1354-1364 |
| Description of Target |
The specific function of SASP is not yet known. |
| Protein Interactions |
CUL2; UCHL5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ASPRV1 (ARP53113_P050) antibody |
| Blocking Peptide |
For anti-ASPRV1 (ARP53113_P050) antibody is Catalog # AAP53113 (Previous Catalog # AAPP35343) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SASP |
| Uniprot ID |
Q53RT3 |
| Protein Name |
Retroviral-like aspartic protease 1 |
| Protein Accession # |
NP_690005 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152792 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ASPRV1 |
| Predicted Species Reactivity |
Human, Rat, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 92%; Horse: 100%; Human: 100%; Rat: 93% |
| Image 1 | Human Lung
 | WB Suggested Anti-SASP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Lung |
|
|
