| Product Number |
ARP53103_P050 |
| Product Page |
www.avivasysbio.com/fbxo15-antibody-n-terminal-region-arp53103-p050.html |
| Name |
FBXO15 Antibody - N-terminal region (ARP53103_P050) |
| Protein Size (# AA) |
434 amino acids |
| Molecular Weight |
49kDa |
| NCBI Gene Id |
201456 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
F-box protein 15 |
| Alias Symbols |
FBX15 |
| Peptide Sequence |
Synthetic peptide located within the following region: QDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Jin,J., (2004) Genes Dev. 18 (21), 2573-2580 |
| Description of Target |
FBXO15 is the substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO15, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM]. |
| Protein Interactions |
CRLS1; UBA7; UBC; ABCB1; SKP1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FBXO15 (ARP53103_P050) antibody |
| Blocking Peptide |
For anti-FBXO15 (ARP53103_P050) antibody is Catalog # AAP53103 (Previous Catalog # AAPP36947) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FBXO15 |
| Uniprot ID |
Q8NCQ5 |
| Protein Name |
F-box only protein 15 |
| Protein Accession # |
NP_689889 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152676 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FBXO15 |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human OVCAR3
 | WB Suggested Anti-FBXO15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: OVCAR-3 cell lysate |
| | Image 2 | Human 293T
 | FBXO15 antibody - N-terminal region (ARP53103_P050) validated by WB using 293T cells lysate at 1:500. |
|
|
