FAM76A Antibody - N-terminal region (ARP53097_P050)

• Name: FAM76A Antibody - N-terminal region (ARP53097_P050)
• Protein Size (# AA): 307 amino acids
• Molecular Weight: 35kDa
• NCBI Gene Id: 199870
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Family with sequence similarity 76, member A
• Alias Symbols: MGC34648, RP3-426I6.1
• Peptide Sequence: Synthetic peptide located within the following region: MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321
• Description of Target: The specific function of FAM76A is not yet known.
• Protein Interactions: UBC; ELAVL1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FAM76A (ARP53097_P050) antibody is Catalog # AAP53097 (Previous Catalog # AAPP35330)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM76A
• Uniprot ID: Q8TAV0
• Protein Name: Protein FAM76A
• Protein Accession #: NP_689873
• Purification: Affinity Purified
• Nucleotide Accession #: NM_152660
• Tested Species Reactivity: Human
• Gene Symbol: FAM76A
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Image 1: Human MCF-7
  
  WB Suggested Anti-FAM76A Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: MCF7 cell lysate