| Product Number |
ARP53051_P050 |
| Product Page |
https://www.avivasysbio.com/ccdc63-antibody-middle-region-arp53051-p050.html |
| Name |
CCDC63 Antibody - middle region (ARP53051_P050) |
| Protein Size (# AA) |
563 amino acids |
| Molecular Weight |
66kDa |
| NCBI Gene Id |
160762 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Coiled-coil domain containing 63 |
| Alias Symbols |
ODA5 |
| Peptide Sequence |
Synthetic peptide located within the following region: EQSSQAYEQRVEAMARMAAMKDRQKKDTSQYNLEIRELERLYAHESKLKS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
The specific function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CCDC63 (ARP53051_P050) antibody |
| Blocking Peptide |
For anti-CCDC63 (ARP53051_P050) antibody is Catalog # AAP53051 (Previous Catalog # AAPP35230) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CCDC63 |
| Uniprot ID |
Q8NA47 |
| Protein Name |
Coiled-coil domain-containing protein 63 |
| Protein Accession # |
NP_689804 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152591 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CCDC63 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 85%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human SH-SYSY
 | WB Suggested Anti-CCDC63 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: SH-SYSY cell lysate |
|
|
