| Product Number |
ARP53031_P050 |
| Product Page |
www.avivasysbio.com/ppm1k-antibody-middle-region-arp53031-p050.html |
| Name |
PPM1K Antibody - middle region (ARP53031_P050) |
| Protein Size (# AA) |
372 amino acids |
| Molecular Weight |
41kDa |
| NCBI Gene Id |
152926 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Protein phosphatase, Mg2+/Mn2+ dependent, 1K |
| Alias Symbols |
BDP, PTMP, PP2Cm, MSUDMV, PP2Ckappa, UG0882E07 |
| Peptide Sequence |
Synthetic peptide located within the following region: AHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFSFSRSFASSGRWA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Joshi,M., (2007) Biochem. Biophys. Res. Commun. 356 (1), 38-44 |
| Description of Target |
PPM1K regulates the mitochondrial permeability transition pore and is essential for cellular survival and development. |
| Protein Interactions |
BIRC2; MYB; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PPM1K (ARP53031_P050) antibody |
| Blocking Peptide |
For anti-PPM1K (ARP53031_P050) antibody is Catalog # AAP53031 (Previous Catalog # AAPP38403) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PPM1K |
| Uniprot ID |
Q8N3J5 |
| Protein Name |
Protein phosphatase 1K, mitochondrial |
| Protein Accession # |
NP_689755 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152542 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PPM1K |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Human Placenta
 | WB Suggested Anti-PPM1K Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta |
|
| Image 2 | Human Spleen, Human Small Intestine
 | Host: Rabbit
Target: PPM1K
Positive control (+): Human Spleen (SP)
Negative control (-): Human Small Intestine (IN)
Antibody concentration: 1ug/ml |
|
