| Product Number |
ARP52941_P050 |
| Product Page |
https://www.avivasysbio.com/ociad2-antibody-middle-region-arp52941-p050.html |
| Name |
OCIAD2 Antibody - middle region (ARP52941_P050) |
| Protein Size (# AA) |
154 amino acids |
| Molecular Weight |
17kDa |
| NCBI Gene Id |
132299 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
OCIA domain containing 2 |
| Alias Symbols |
DKFZp686C03164, MGC45416 |
| Peptide Sequence |
Synthetic peptide located within the following region: QGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954 |
| Description of Target |
The exact function of OCIAD2 is not known. |
| Protein Interactions |
RNF2; UBC; MMGT1; ILF3; APP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-OCIAD2 (ARP52941_P050) antibody |
| Blocking Peptide |
For anti-OCIAD2 (ARP52941_P050) antibody is Catalog # AAP52941 (Previous Catalog # AAPP34926) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human OCIAD2 |
| Uniprot ID |
Q56VL3 |
| Protein Name |
OCIA domain-containing protein 2 |
| Protein Accession # |
NP_001014446 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001014446 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
OCIAD2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human 293T
 | WB Suggested Anti-OCIAD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate |
|
|
