| Product Number |
ARP52921_P050 |
| Product Page |
https://www.avivasysbio.com/prxl2b-antibody-middle-region-arp52921-p050.html |
| Name |
PRXL2B Antibody - middle region (ARP52921_P050) |
| Protein Size (# AA) |
198 amino acids |
| Molecular Weight |
21kDa |
| NCBI Gene Id |
127281 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
peroxiredoxin like 2B |
| Alias Symbols |
C1orf93, FAM213B |
| Peptide Sequence |
Synthetic peptide located within the following region: RYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Interactions |
UBC; TNFSF11; PDPK1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PRXL2B (ARP52921_P050) antibody |
| Blocking Peptide |
For anti-PRXL2B (ARP52921_P050) antibody is Catalog # AAP52921 (Previous Catalog # AAPP34907) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human C1orf93 |
| Uniprot ID |
Q5R7S9 |
| Protein Name |
prostamide/prostaglandin F synthase |
| Protein Accession # |
NP_689584 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152371 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PRXL2B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Human PANC1
 | WB Suggested Anti-C1orf93 Antibody Titration: 0.2-1 ug/ml
Positive Control: PANC1 cell lysate |
|
|
