Product Number |
ARP52920_P050 |
Product Page |
www.avivasysbio.com/2810405k02rik-antibody-middle-region-arp52920-p050.html |
Name |
Prxl2b Antibody - middle region (ARP52920_P050) |
Protein Size (# AA) |
201 amino acids |
Molecular Weight |
22kDa |
NCBI Gene Id |
66469 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
RIKEN cDNA 2810405K02 gene |
Alias Symbols |
PM/P, Fam213, Fam213b, PM/PGFS, AI836168, 2810405K02Rik |
Peptide Sequence |
Synthetic peptide located within the following region: SKQIYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
2810405K02Rik catalyzes the reduction of prostaglandin-ethanolamide H2 (prostamide H2) to prostamide F(2alpha) with NADPH as proton donor. It also be able to reduce prostaglandin H2 to prostaglandin F(2alpha). |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Fam213b (ARP52920_P050) antibody |
Blocking Peptide |
For anti-Fam213b (ARP52920_P050) antibody is Catalog # AAP52920 (Previous Catalog # AAPP34906) |
Uniprot ID |
Q9DB60 |
Protein Name |
Prostamide/prostaglandin F synthase |
Protein Accession # |
NP_079858 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_025582 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Fam213b |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100% |
Image 1 | Mouse Thymus
| WB Suggested Anti-2810405K02Rik Antibody Titration: 1.0 ug/ml Positive Control: Mouse Thymus |
|
|