| Product Number |
ARP52895_P050 |
| Product Page |
www.avivasysbio.com/tc2n-antibody-middle-region-arp52895-p050.html |
| Name |
TC2N Antibody - middle region (ARP52895_P050) |
| Protein Size (# AA) |
490 amino acids |
| Molecular Weight |
55kDa |
| NCBI Gene Id |
123036 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Tandem C2 domains, nuclear |
| Alias Symbols |
C2CD1, Tac2-N, MTAC2D1, C14orf47 |
| Peptide Sequence |
Synthetic peptide located within the following region: SWPSSYGDTPTVSIKGILTLPKPVHFKSSAKEGSNAIEFMETFVFAIKLQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006) |
| Description of Target |
The specific function of TC2N is not yet known. |
| Protein Interactions |
ELAVL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TC2N (ARP52895_P050) antibody |
| Blocking Peptide |
For anti-TC2N (ARP52895_P050) antibody is Catalog # AAP52895 (Previous Catalog # AAPP35214) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TC2N |
| Uniprot ID |
Q8N9U0 |
| Protein Name |
Tandem C2 domains nuclear protein |
| Protein Accession # |
NP_689545 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152332 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TC2N |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 93% |
| Image 1 | Human MCF-7
 | WB Suggested Anti-TC2N Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate |
|
|
