| Product Number |
ARP52859_P050 |
| Product Page |
www.avivasysbio.com/mtpn-antibody-middle-region-arp52859-p050.html |
| Name |
MTPN Antibody - middle region (ARP52859_P050) |
| Protein Size (# AA) |
118 amino acids |
| Molecular Weight |
13kDa |
| NCBI Gene Id |
136319 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Myotrophin |
| Alias Symbols |
V-1, GCDP |
| Peptide Sequence |
Synthetic peptide located within the following region: GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Xiong,Z., (2006) J. Immunol. 177 (7), 4907-4916 |
| Description of Target |
MTPN has a potential role in cerebellar morphogenesis. MTPN may function in differentiation of cerebellar neurons, particularly of granule cells. MTPN seems to be associated with cardiac hypertrophy.The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3' end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease. |
| Protein Interactions |
RBBP4; RAB1A; PTPN11; OXCT1; MTAP; PDIA3; ATP6V1A; UBC; NPLOC4; ELAVL1; MAPK1; CAPZB; RELA; NFKB1; REL; DSTYK; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MTPN (ARP52859_P050) antibody |
| Blocking Peptide |
For anti-MTPN (ARP52859_P050) antibody is Catalog # AAP52859 (Previous Catalog # AAPP33916) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MTPN |
| Uniprot ID |
P58546 |
| Protein Name |
Myotrophin |
| Publications |
Nghiem, P. P. et al. Sparing of the dystrophin-deficient cranial sartorius muscle is associated with classical and novel hypertrophy pathways in GRMD dogs. Am. J. Pathol. 183, 1411-24 (2013). 24160322 |
| Protein Accession # |
NP_665807 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_145808 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MTPN |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Human Thymus
 | WB Suggested Anti-MTPN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Thymus |
|
|
