Product Number |
ARP52851_P050 |
Product Page |
www.avivasysbio.com/stoml3-antibody-n-terminal-region-arp52851-p050.html |
Name |
STOML3 Antibody - N-terminal region (ARP52851_P050) |
Protein Size (# AA) |
291 amino acids |
Molecular Weight |
32kDa |
NCBI Gene Id |
161003 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Stomatin (EPB72)-like 3 |
Alias Symbols |
SRO, Epb7.2l |
Peptide Sequence |
Synthetic peptide located within the following region: SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Dunham,A., (2004) Nature 428 (6982), 522-528 |
Description of Target |
The specific function of the protein remains unknown. |
Protein Interactions |
APP; CAV1; ADCY3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-STOML3 (ARP52851_P050) antibody |
Blocking Peptide |
For anti-STOML3 (ARP52851_P050) antibody is Catalog # AAP52851 (Previous Catalog # AAPP33909) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human STOML3 |
Uniprot ID |
Q8TAV4 |
Protein Name |
Stomatin-like protein 3 |
Protein Accession # |
NP_660329 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_145286 |
Tested Species Reactivity |
Human |
Gene Symbol |
STOML3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human 721_B
| WB Suggested Anti-STOML3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: 721_B cell lysate |
|
|