| Product Number |
ARP52851_P050 |
| Product Page |
www.avivasysbio.com/stoml3-antibody-n-terminal-region-arp52851-p050.html |
| Name |
STOML3 Antibody - N-terminal region (ARP52851_P050) |
| Protein Size (# AA) |
291 amino acids |
| Molecular Weight |
32kDa |
| NCBI Gene Id |
161003 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Stomatin (EPB72)-like 3 |
| Alias Symbols |
SRO, Epb7.2l |
| Peptide Sequence |
Synthetic peptide located within the following region: SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Dunham,A., (2004) Nature 428 (6982), 522-528 |
| Description of Target |
The specific function of the protein remains unknown. |
| Protein Interactions |
APP; CAV1; ADCY3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-STOML3 (ARP52851_P050) antibody |
| Blocking Peptide |
For anti-STOML3 (ARP52851_P050) antibody is Catalog # AAP52851 (Previous Catalog # AAPP33909) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human STOML3 |
| Uniprot ID |
Q8TAV4 |
| Protein Name |
Stomatin-like protein 3 |
| Protein Accession # |
NP_660329 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_145286 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
STOML3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human 721_B
 | WB Suggested Anti-STOML3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate |
|
|
