| Product Number |
ARP52848_P050 |
| Product Page |
www.avivasysbio.com/nxnl2-antibody-middle-region-arp52848-p050.html |
| Name |
NXNL2 Antibody - middle region (ARP52848_P050) |
| Protein Size (# AA) |
135 amino acids |
| Molecular Weight |
15kDa |
| NCBI Gene Id |
158046 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Nucleoredoxin-like 2 |
| Alias Symbols |
RDCVF2, RdCVF2L, C9orf121 |
| Peptide Sequence |
Synthetic peptide located within the following region: SADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Humphray,S.J., (2004) Nature 429 (6990), 369-374 |
| Description of Target |
The specific function of the protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NXNL2 (ARP52848_P050) antibody |
| Blocking Peptide |
For anti-NXNL2 (ARP52848_P050) antibody is Catalog # AAP52848 (Previous Catalog # AAPP33907) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human NXNL2 |
| Uniprot ID |
Q5VZ03-3 |
| Protein Accession # |
NP_660326 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_145283 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NXNL2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 90%; Horse: 90%; Human: 100%; Mouse: 100%; Pig: 80%; Rabbit: 90%; Rat: 92% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-NXNL2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
|
