| Product Number |
ARP52779_P050-Biotin |
| Product Page |
www.avivasysbio.com/arl13b-antibody-middle-region-biotin-arp52779-p050-biotin.html |
| Name |
ARL13B Antibody - middle region : Biotin (ARP52779_P050-Biotin) |
| Protein Size (# AA) |
428 amino acids |
| Molecular Weight |
48 kDa |
| Conjugation |
Biotin |
| NCBI Gene Id |
200894 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ADP-ribosylation factor-like 13B |
| Alias Symbols |
JBTS8, ARL2L1 |
| Peptide Sequence |
Synthetic peptide located within the following region: VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Fan,Y., (2004) Nat. Genet. 36 (9), 989-993 |
| Description of Target |
ARL13B has an evolutionarily conserved role mediating cilia function in multiple organs. N and C domains of ARL13B cooperatively regulate its ciliary localization and that N domain-dependent self-association of Arl13b may be important for its function in cilia biogenesis. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-ARL13B (ARP52779_P050-Biotin) antibody |
| Blocking Peptide |
For anti-ARL13B (ARP52779_P050-Biotin) antibody is Catalog # AAP52779 (Previous Catalog # AAPP33738) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ARL13B |
| Uniprot ID |
Q8TCL5 |
| Protein Name |
Putative uncharacterized protein DKFZp761H079 EMBL CAD28544.2 |
| Publications |
Zhang, Z. et al. Fuz regulates craniofacial development through tissue specific responses to signaling factors. PLoS One 6, e24608 (2011). WB, IHC, Human, Guinea pig, Bovine, Dog, Rabbit, Rat, Mouse, Horse, Zebrafish 21935430 |
| Protein Accession # |
NP_659433 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_144996 |
| Gene Symbol |
ARL13B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 79% |
| Image 1 | |
|
