ARL13B Antibody - middle region (ARP52779_P050)

• Product Number: ARP52779_P050
• Name: ARL13B Antibody - middle region (ARP52779_P050)
• Protein Size (# AA): 428 amino acids
• Molecular Weight: 48 kDa
• NCBI Gene Id: 200894
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: ADP-ribosylation factor-like 13B
• Alias Symbols: JBTS8, ARL2L1
• Peptide Sequence: Synthetic peptide located within the following region: VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Fan,Y., (2004) Nat. Genet. 36 (9), 989-993
• Description of Target: ARL13B has an evolutionarily conserved role mediating cilia function in multiple organs. N and C domains of ARL13B cooperatively regulate its ciliary localization and that N domain-dependent self-association of Arl13b may be important for its function in cilia biogenesis.
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-ARL13B (ARP52779_P050) antibody is Catalog # AAP52779 (Previous Catalog # AAPP33738)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARL13B
• Uniprot ID: Q8TCL5
• Protein Name: Putative uncharacterized protein DKFZp761H079 EMBL CAD28544.2
• Publications:

  Zhang, Z. et al. Fuz regulates craniofacial development through tissue specific responses to signaling factors. PLoS One 6, e24608 (2011). 21935430

• Protein Accession #: NP_659433
• Purification: Affinity Purified
• Nucleotide Accession #: NM_144996
• Tested Species Reactivity: Human
• Gene Symbol: ARL13B
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 79%
• Image 1: Human Fetal Lung
  
  Host: Rabbit
  Target Name: ARL13B
  Sample Tissue: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 2: Lung tumor, Human liver
  
  Host: Rabbit
  Target: ARL13B
  Positive control (+): Lung tumor (T-LU)
  Negative control (-): Human liver (LI)
  Antibody concentration: 1ug/ml