TEKT4 Antibody - N-terminal region (ARP52746_P050)

Data Sheet
 
Product Number ARP52746_P050
Product Page https://www.avivasysbio.com/tekt4-antibody-n-terminal-region-arp52746-p050.html
Name TEKT4 Antibody - N-terminal region (ARP52746_P050)
Protein Size (# AA) 435 amino acids
Molecular Weight 51kDa
NCBI Gene Id 150483
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Tektin 4
Alias Symbols MGC27019
Peptide Sequence Synthetic peptide located within the following region: TSKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hillier,L.W., (2005) Nature 434 (7034), 724-731
Description of Target TEKT4 belongs to the tektin family.TEKT4 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules.
Protein Interactions KRTAP26-1; PRDM14; GSE1; IKZF3; ATG5; RECK; TRIP6; TADA2A; RARA; HNRNPM; MAGEA4; SMAD3; SLC25A6; ALAS1; KRT15;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TEKT4 (ARP52746_P050) antibody
Blocking Peptide For anti-TEKT4 (ARP52746_P050) antibody is Catalog # AAP52746 (Previous Catalog # AAPP33628)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TEKT4
Uniprot ID Q8WW24
Protein Name Tektin-4
Protein Accession # NP_653306
Purification Affinity Purified
Nucleotide Accession # NM_144705
Tested Species Reactivity Human
Gene Symbol TEKT4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 91%; Pig: 92%; Rat: 92%
Image 1
Human HeLa
WB Suggested Anti-TEKT4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate