| Product Number |
ARP52729_P050 |
| Product Page |
https://www.avivasysbio.com/wdr66-antibody-n-terminal-region-arp52729-p050.html |
| Name |
WDR66 Antibody - N-terminal region (ARP52729_P050) |
| Protein Size (# AA) |
1149 amino acids |
| Molecular Weight |
130kDa |
| NCBI Gene Id |
144406 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
WD repeat domain 66 |
| Alias Symbols |
WDR66, SPGF33, CaM-IP4 |
| Peptide Sequence |
Synthetic peptide located within the following region: GELEEKTDRMPQDELGQERRDLEPENREEGQERRVSDIQSKAGISRESLV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
WDR66 contains 9 WD repeats. The functions of WDR66 remain unknown. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-WDR66 (ARP52729_P050) antibody |
| Blocking Peptide |
For anti-WDR66 (ARP52729_P050) antibody is Catalog # AAP52729 (Previous Catalog # AAPP33611) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human WDR66 |
| Uniprot ID |
Q8TBY9 |
| Protein Name |
WD repeat-containing protein 66 |
| Protein Accession # |
NP_653269 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_144668 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
WDR66 |
| Predicted Species Reactivity |
Human, Dog, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Human: 100%; Pig: 85% |
| Image 1 | Human HepG2
 | WB Suggested Anti-WDR66 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate |
|
|
