Product Number |
ARP52729_P050 |
Product Page |
https://www.avivasysbio.com/wdr66-antibody-n-terminal-region-arp52729-p050.html |
Name |
WDR66 Antibody - N-terminal region (ARP52729_P050) |
Protein Size (# AA) |
1149 amino acids |
Molecular Weight |
130kDa |
NCBI Gene Id |
144406 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
WD repeat domain 66 |
Alias Symbols |
WDR66, SPGF33, CaM-IP4 |
Peptide Sequence |
Synthetic peptide located within the following region: GELEEKTDRMPQDELGQERRDLEPENREEGQERRVSDIQSKAGISRESLV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
WDR66 contains 9 WD repeats. The functions of WDR66 remain unknown. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-WDR66 (ARP52729_P050) antibody |
Blocking Peptide |
For anti-WDR66 (ARP52729_P050) antibody is Catalog # AAP52729 (Previous Catalog # AAPP33611) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human WDR66 |
Uniprot ID |
Q8TBY9 |
Protein Name |
WD repeat-containing protein 66 |
Protein Accession # |
NP_653269 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_144668 |
Tested Species Reactivity |
Human |
Gene Symbol |
WDR66 |
Predicted Species Reactivity |
Human, Dog, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Human: 100%; Pig: 85% |
Image 1 | Human HepG2
 | WB Suggested Anti-WDR66 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
|
|