Product Number |
ARP52691_P050 |
Product Page |
https://www.avivasysbio.com/lrrc28-antibody-c-terminal-region-arp52691-p050.html |
Name |
LRRC28 Antibody - C-terminal region (ARP52691_P050) |
Protein Size (# AA) |
367 amino acids |
Molecular Weight |
42kDa |
NCBI Gene Id |
123355 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Leucine rich repeat containing 28 |
Alias Symbols |
FLJ34269, FLJ45242, MGC24976 |
Peptide Sequence |
Synthetic peptide located within the following region: KDLNFLSPISLPRSLLELLHCPLGHCHRCSEPMFTIVYPKLFPLRETPMA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270 |
Description of Target |
LRRC28 contains 11 LRR (leucine-rich) repeats. The function of the LRRC28 protein is not known. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LRRC28 (ARP52691_P050) antibody |
Blocking Peptide |
For anti-LRRC28 (ARP52691_P050) antibody is Catalog # AAP52691 (Previous Catalog # AAPY03771) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human LRRC28 |
Uniprot ID |
Q86X40 |
Protein Name |
Leucine-rich repeat-containing protein 28 |
Protein Accession # |
NP_653199 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_144598 |
Tested Species Reactivity |
Human |
Gene Symbol |
LRRC28 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100% |
Image 1 | Human Brain
 | WB Suggested Anti-LRRC28 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human brain |
|
|