LRRC28 Antibody - C-terminal region (ARP52691_P050)

• Name: LRRC28 Antibody - C-terminal region (ARP52691_P050)
• Protein Size (# AA): 367 amino acids
• Molecular Weight: 42kDa
• NCBI Gene Id: 123355
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Leucine rich repeat containing 28
• Alias Symbols: FLJ34269, FLJ45242, MGC24976
• Peptide Sequence: Synthetic peptide located within the following region: KDLNFLSPISLPRSLLELLHCPLGHCHRCSEPMFTIVYPKLFPLRETPMA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270
• Description of Target: LRRC28 contains 11 LRR (leucine-rich) repeats. The function of the LRRC28 protein is not known.
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-LRRC28 (ARP52691_P050) antibody is Catalog # AAP52691 (Previous Catalog # AAPY03771)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LRRC28
• Uniprot ID: Q86X40
• Protein Name: Leucine-rich repeat-containing protein 28
• Protein Accession #: NP_653199
• Purification: Affinity Purified
• Nucleotide Accession #: NM_144598
• Tested Species Reactivity: Human
• Gene Symbol: LRRC28
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
• Image 1: Human Brain
  
  WB Suggested Anti-LRRC28 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human brain