| Product Number |
ARP52687_P050 |
| Product Page |
www.avivasysbio.com/slain1-antibody-middle-region-arp52687-p050.html |
| Name |
SLAIN1 Antibody - middle region (ARP52687_P050) |
| Protein Size (# AA) |
349 amino acids |
| Molecular Weight |
38kDa |
| NCBI Gene Id |
122060 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SLAIN motif family, member 1 |
| Alias Symbols |
C13orf32 |
| Peptide Sequence |
Synthetic peptide located within the following region: RSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hirst,C.E., (2006) Dev. Biol. 293 (1), 90-103 |
| Description of Target |
The exact function of this protein remains unknown. |
| Protein Interactions |
PSMA3; FHL3; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLAIN1 (ARP52687_P050) antibody |
| Blocking Peptide |
For anti-SLAIN1 (ARP52687_P050) antibody is Catalog # AAP52687 (Previous Catalog # AAPY03767) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SLAIN1 |
| Uniprot ID |
Q8ND83 |
| Protein Name |
SLAIN motif-containing protein 1 |
| Protein Accession # |
NP_001035243 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001040153 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLAIN1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-SLAIN1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
|
