| Product Number |
ARP52640_P050 |
| Product Page |
https://www.avivasysbio.com/cant1-antibody-middle-region-arp52640-p050.html |
| Name |
CANT1 Antibody - middle region (ARP52640_P050) |
| Protein Size (# AA) |
401 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
124583 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Calcium activated nucleotidase 1 |
| Alias Symbols |
DBQD, EDM7, DBQD1, SCAN1, SHAPY, SCAN-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hermans,K.G., (2008) Cancer Res. 68 (9), 3094-3098 |
| Description of Target |
CANT1 belongs to the apyrase family.It is a calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > UTP > GTP. The enzyme has very low activity towards ADP and even lower activity towards ATP. And it does not hydrolyze AMP and GMP. |
| Protein Interactions |
UBD; CANT1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CANT1 (ARP52640_P050) antibody |
| Blocking Peptide |
For anti-CANT1 (ARP52640_P050) antibody is Catalog # AAP52640 (Previous Catalog # AAPY03721) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CANT1 |
| Uniprot ID |
Q8WVQ1 |
| Protein Name |
Soluble calcium-activated nucleotidase 1 |
| Protein Accession # |
NP_620148 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_138793 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CANT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-CANT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Transfected 293T |
|
