| Product Number |
ARP52634_P050-Biotin |
| Product Page |
www.avivasysbio.com/c11orf74-antibody-middle-region-biotin-arp52634-p050-biotin.html |
| Name |
C11orf74 Antibody - middle region : Biotin (ARP52634_P050-Biotin) |
| Protein Size (# AA) |
221 amino acids |
| Molecular Weight |
25kDa |
| Conjugation |
Biotin |
| NCBI Gene Id |
119710 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Chromosome 11 open reading frame 74 |
| Alias Symbols |
NWC, HEPIS, C11orf74 |
| Peptide Sequence |
Synthetic peptide located within the following region: VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
The exact function of C11orf74 remains unknown. |
| Protein Interactions |
SMARCC2; SLC10A1; PPP1CC; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-C11orf74 (ARP52634_P050-Biotin) antibody |
| Blocking Peptide |
For anti-C11orf74 (ARP52634_P050-Biotin) antibody is Catalog # AAP52634 (Previous Catalog # AAPY03715) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human C11orf74 |
| Uniprot ID |
Q86VG3 |
| Protein Name |
Uncharacterized protein C11orf74 |
| Protein Accession # |
NP_620142 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_138787 |
| Gene Symbol |
C11orf74 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | |
|
