| Product Number |
ARP52634_P050 |
| Product Page |
www.avivasysbio.com/c11orf74-antibody-middle-region-arp52634-p050.html |
| Name |
C11orf74 Antibody - middle region (ARP52634_P050) |
| Protein Size (# AA) |
221 amino acids |
| Molecular Weight |
25kDa |
| NCBI Gene Id |
119710 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Chromosome 11 open reading frame 74 |
| Alias Symbols |
NWC, HEPIS, C11orf74 |
| Peptide Sequence |
Synthetic peptide located within the following region: VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
The exact function of C11orf74 remains unknown. |
| Protein Interactions |
SMARCC2; SLC10A1; PPP1CC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-C11orf74 (ARP52634_P050) antibody |
| Blocking Peptide |
For anti-C11orf74 (ARP52634_P050) antibody is Catalog # AAP52634 (Previous Catalog # AAPY03715) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human C11orf74 |
| Uniprot ID |
Q86VG3 |
| Protein Name |
Uncharacterized protein C11orf74 |
| Protein Accession # |
NP_620142 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_138787 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
C11orf74 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Muscle
 | WB Suggested Anti-C11orf74 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle |
|
|
