| Product Number |
ARP52586_P050 |
| Product Page |
https://www.avivasysbio.com/josd2-antibody-n-terminal-region-arp52586-p050.html |
| Name |
JOSD2 Antibody - N-terminal region (ARP52586_P050) |
| Protein Size (# AA) |
188 amino acids |
| Molecular Weight |
21kDa |
| NCBI Gene Id |
126119 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Josephin domain containing 2 |
| Alias Symbols |
SBBI54 |
| Peptide Sequence |
Synthetic peptide located within the following region: QQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Albrecht,M., (2003) Proteins 50 (2), 355-370 |
| Description of Target |
The specific function of JOSD2 is not yet known. |
| Protein Interactions |
STUB1; UBC; PLA2G2A; TYSND1; AHCYL2; AHCYL1; SMARCA2; TRAPPC2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-JOSD2 (ARP52586_P050) antibody |
| Blocking Peptide |
For anti-JOSD2 (ARP52586_P050) antibody is Catalog # AAP52586 (Previous Catalog # AAPS32503) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human JOSD2 |
| Uniprot ID |
Q8TAC2 |
| Protein Name |
Josephin-2 |
| Protein Accession # |
NP_612207 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_138334 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
JOSD2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-JOSD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T |
|
| Image 2 |
 | Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
|
|
| Image 3 |
 | The serial dilutions of 50ug/mL of antibody were captured on the Protein A/G surface of the PAGHC200M chip in duplicates. The chip was washed with 1xHBSTE Buffer + 0.5mg/mL BSA (bovine serum albumin) after capturing. Peptide Antigens were applied in 330nM and fitted for association (600s = 10 min) and dissociation phases (900s = 15min). The fitted curves are shown in red. |
|
