KIAA1958 Antibody - C-terminal region : Biotin (ARP52567_P050-Biotin)

Data Sheet
 
Product Number ARP52567_P050-Biotin
Product Page www.avivasysbio.com/kiaa1958-antibody-c-terminal-region-biotin-arp52567-p050-biotin.html
Name KIAA1958 Antibody - C-terminal region : Biotin (ARP52567_P050-Biotin)
Protein Size (# AA) 570 amino acids
Molecular Weight 62kDa
Conjugation Biotin
NCBI Gene Id 158405
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name KIAA1958
Alias Symbols RP11-276E15.5, FLJ39294, MGC142075
Peptide Sequence Synthetic peptide located within the following region: SPITLLSTVVKYNSQYLNMRTLQEHADLMYGDIELLKDPQNQPYFARTDS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target The exact function of KIAA1958 remains unknown.
Protein Interactions KIAA1958; CEP19; COASY; FAM124B; GABARAPL2; MCRS1; RWDD2B; SOCS3; LMO4; TCEA2; STAC; AQP1; SUMO2;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-KIAA1958 (ARP52567_P050-Biotin) antibody
Blocking Peptide For anti-KIAA1958 (ARP52567_P050-Biotin) antibody is Catalog # AAP52567 (Previous Catalog # AAPS32308)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human KIAA1958
Uniprot ID Q8N8K9
Protein Name Uncharacterized protein KIAA1958
Protein Accession # EAW59109
Purification Affinity Purified
Nucleotide Accession # NM_133465
Gene Symbol KIAA1958
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com