Product Number |
ARP52537_P050 |
Product Page |
www.avivasysbio.com/asz1-antibody-middle-region-arp52537-p050.html |
Name |
ASZ1 Antibody - middle region (ARP52537_P050) |
Protein Size (# AA) |
475 amino acids |
Molecular Weight |
53kDa |
NCBI Gene Id |
136991 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Ankyrin repeat, SAM and basic leucine zipper domain containing 1 |
Alias Symbols |
ALP1, GASZ, Orf3, ANKL1, C7orf7, CT1.19 |
Peptide Sequence |
Synthetic peptide located within the following region: GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
ASZ1 plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity.ASZ1 acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Its association with pi-bodies suggests a participation in the primary piRNAs metabolic process.ASZ1 is required prior to the pachytene stage to facilitate the production of multiple types of piRNAs, including those associated with repeats involved in regulation of retrotransposons.ASZ1 may act by mediating protein-protein interactions during germ cell maturation. |
Protein Interactions |
TSG101; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ASZ1 (ARP52537_P050) antibody |
Blocking Peptide |
For anti-ASZ1 (ARP52537_P050) antibody is Catalog # AAP52537 (Previous Catalog # AAPP42844) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ASZ1 |
Uniprot ID |
Q8WWH4 |
Protein Name |
Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 |
Protein Accession # |
NP_570124 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_130768 |
Tested Species Reactivity |
Human |
Gene Symbol |
ASZ1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93% |
Image 1 | Human THP-1
| WB Suggested Anti-ASZ1 Antibody Titration: 1.0 ug/ml Positive Control: THP-1 Whole Cell |
|
|