| Product Number |
ARP52524_P050 |
| Product Page |
www.avivasysbio.com/neurl2-antibody-n-terminal-region-arp52524-p050.html |
| Name |
NEURL2 Antibody - N-terminal region (ARP52524_P050) |
| Protein Size (# AA) |
285 amino acids |
| Molecular Weight |
32kDa |
| NCBI Gene Id |
140825 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Neuralized homolog 2 (Drosophila) |
| Alias Symbols |
OZZ, OZZ-E3, C20orf163 |
| Peptide Sequence |
Synthetic peptide located within the following region: MAAASEPVDSGALWGLERPEPPPTRFHRVHGANIRVDPSGTRATRVESFA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Song,R., (2006) J. Biol. Chem. 281 (47), 36391-36400 |
| Description of Target |
NEURL2 contains 1 NHR (neuralized homology repeat) domain and 1 SOCS box domain. NEURL2 plays an important role in the process of myofiber differentiation and maturation. NEURL2 is the probable substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex, which mediates the ubiquitination of proteins. NEURL2 probably contributes to catalysis through recognition and positioning of the substrate and the ubiquitin-conjugating enzyme. During myogenesis, it controls the ubiquitination and degradation of the specific pool of CTNNB1/beta-catenin located at the sarcolemma. |
| Protein Interactions |
CTNNB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NEURL2 (ARP52524_P050) antibody |
| Blocking Peptide |
For anti-NEURL2 (ARP52524_P050) antibody is Catalog # AAP52524 (Previous Catalog # AAPP30437) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NEURL2 |
| Uniprot ID |
Q9BR09 |
| Protein Name |
Neuralized-like protein 2 |
| Protein Accession # |
NP_542787 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_080749 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NEURL2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100% |
| Image 1 | Human Muscle
 | WB Suggested Anti-NEURL2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle |
|
|
