| Product Number |
ARP52505_P050 |
| Product Page |
www.avivasysbio.com/cbln4-antibody-c-terminal-region-arp52505-p050.html |
| Name |
CBLN4 Antibody - C-terminal region (ARP52505_P050) |
| Protein Size (# AA) |
201 amino acids |
| Molecular Weight |
22kDa |
| NCBI Gene Id |
140689 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cerebellin 4 precursor |
| Description |
|
| Alias Symbols |
CBLNL1 |
| Peptide Sequence |
Synthetic peptide located within the following region: HVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824 |
| Description of Target |
Cerebellin is a sixteen aa peptide found mainly in the adrenal medulla, where it has been shown to have a neuromodulatory function. Cerebellin is derived from precerebellin, a protein with sequence similarity to the noncollagen domain of complement component C1qB. CBLN4 is a glycoprotein which shares sequence similarity with precerebellin.Cerebellin is a sixteen aa peptide found mainly in the adrenal medulla, where it has been shown to have a neuromodulatory function. Cerebellin is derived from precerebellin, a protein with sequence similarity to the noncollagen domain of complement component C1qB. The protein encoded by this gene is a glycoprotein which shares sequence similarity with precerebellin. |
| Protein Interactions |
SRPK2; CBLN3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CBLN4 (ARP52505_P050) antibody |
| Additional Information |
IHC Information: Human Brain, Cortex (formalin-fixed, paraffin-embedded) stained with CBLN4 antibody ARP52505_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
IHC Information: Human Brain, Cortex (formalin-fixed, paraffin-embedded) stained with CBLN4 antibody ARP52505_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen. |
| Blocking Peptide |
For anti-CBLN4 (ARP52505_P050) antibody is Catalog # AAP52505 (Previous Catalog # AAPP30419) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CBLN4 |
| Uniprot ID |
Q9NTU7 |
| Protein Name |
Cerebellin-4 |
| Publications |
Glycosylation of Cblns attenuates their receptor binding. Brain Res. 1694, 129-139 (2018) 29782851
Gupta, S. et al. Human organic cation transporter 1 is expressed in lymphoma cells and increases susceptibility to irinotecan and paclitaxel. J. Pharmacol. Exp. Ther. 341, 16-23 (2012). 22220752 |
| Protein Accession # |
NP_542184 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_080617 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CBLN4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human HeLa
 | WB Suggested Anti-CBLN4 Antibody Titration: 1 ug/ml
Positive Control: Hela cell lysate |
|
| Image 2 | Human cortex
 | Immunohistochemistry with Human, cortex tissue at an antibody concentration of 5.0ug/ml using anti-CBLN4 antibody (ARP52505_P050) |
|
| Image 3 | Human cortex
 | Human cortex |
|
