AZIN2 Antibody - middle region (ARP52476_P050)

Data Sheet
 
Product Number ARP52476_P050
Product Page www.avivasysbio.com/azin2-antibody-middle-region-arp52476-p050.html
Name AZIN2 Antibody - middle region (ARP52476_P050)
Protein Size (# AA) 460 amino acids
Molecular Weight 50kDa
NCBI Gene Id 113451
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name antizyme inhibitor 2
Alias Symbols ADC, AZI2, ODCp, AZIB1, ODC-p, ODC1L
Peptide Sequence Synthetic peptide located within the following region: RHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene belongs to the antizyme inhibitor family, which plays a role in cell growth and proliferation by maintaining polyamine homeostasis within the cell. Antizyme inhibitors are homologs of ornithine decarboxylase (ODC, the key enzyme in polyamine biosynthesis) that have lost the ability to decarboxylase ornithine; however, retain the ability to bind to antizymes. Antizymes negatively regulate intracellular polyamine levels by binding to ODC and targeting it for degradation, as well as by inhibiting polyamine uptake. Antizyme inhibitors function as positive regulators of polyamine levels by sequestering antizymes and neutralizing their effect. This gene encodes antizyme inhibitor 2, the second member of this gene family. Like antizyme inhibitor 1, antizyme inhibitor 2 interacts with all 3 antizymes and stimulates ODC activity and polyamine uptake. However, unlike antizyme inhibitor 1, which is ubiquitously expressed and localized in the nucleus and cytoplasm, antizyme inhibitor 2 is predominantly expressed in the brain and testis and localized in the endoplasmic reticulum-golgi intermediate compartment. Recent studies indicate that antizyme inhibitor 2 is also expressed in specific cell types in ovaries, adrenal glands and pancreas, and in mast cells. The exact function of this gene is not known, however, available data suggest its role in cell growth, spermiogenesis, vesicular trafficking and secretion. Accumulation of antizyme inhibitor 2 has also been observed in brains of patients with Alzheimer's disease. There has been confusion in literature and databases over the nomenclature of this gene, stemming from an earlier report that a human cDNA clone (identical to ODCp/AZIN2) had arginine decarboxylase (ADC) activity (PMID:14738999). Subsequent studies in human and mouse showed that antizyme inhibitor 2 was devoid of arginine decarboxylase activity (PMID:19956990). Alternatively spliced transcript variants have been described for this gene.
Protein Interactions OAZ3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-AZIN2 (ARP52476_P050) antibody
Blocking Peptide For anti-AZIN2 (ARP52476_P050) antibody is Catalog # AAP52476 (Previous Catalog # AAPP30314)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ADC
Uniprot ID Q96A70
Protein Name antizyme inhibitor 2
Protein Accession # NP_443724
Purification Affinity Purified
Nucleotide Accession # NM_052998
Tested Species Reactivity Human
Gene Symbol AZIN2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 79%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human COLO205
WB Suggested Anti-ADC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: COLO205 cell lysate
Image 2
Human, Rat
Sample Type: Human and Rat Cerebral CortexPrimary Dilution: 1:3000
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com