Product Number |
ARP52475_P050 |
Product Page |
www.avivasysbio.com/lrg1-antibody-n-terminal-region-arp52475-p050.html |
Name |
LRG1 Antibody - N-terminal region (ARP52475_P050) |
Protein Size (# AA) |
347 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
116844 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Leucine-rich alpha-2-glycoprotein 1 |
Alias Symbols |
LRG, HMFT1766 |
Peptide Sequence |
Synthetic peptide located within the following region: GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O'Donnell et al., 2002 [PubMed 12223515]). |
Protein Interactions |
FN1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LRG1 (ARP52475_P050) antibody |
Blocking Peptide |
For anti-LRG1 (ARP52475_P050) antibody is Catalog # AAP52475 (Previous Catalog # AAPP42935) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LRG1 |
Uniprot ID |
P02750 |
Protein Name |
Leucine-rich alpha-2-glycoprotein |
Publications |
OâHanlon, T. P. et al. Plasma proteomic profiles from disease-discordant monozygotic twins suggest that molecular pathways are shared in multiple systemic autoimmune diseases. Arthritis Res. Ther. 13, R181 (2011). 22044644 |
Protein Accession # |
NP_443204 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_052972 |
Tested Species Reactivity |
Human |
Gene Symbol |
LRG1 |
Predicted Species Reactivity |
Human, Cow, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Human: 100%; Pig: 79% |
Image 1 | Human Lung
| WB Suggested Anti-LRG1 Antibody Titration: 0.2-1 ug/ml Positive Control: Human Lung |
|
|