LRG1 Antibody - N-terminal region (ARP52475_P050)

Data Sheet
 
Product Number ARP52475_P050
Product Page www.avivasysbio.com/lrg1-antibody-n-terminal-region-arp52475-p050.html
Name LRG1 Antibody - N-terminal region (ARP52475_P050)
Protein Size (# AA) 347 amino acids
Molecular Weight 38kDa
NCBI Gene Id 116844
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Leucine-rich alpha-2-glycoprotein 1
Alias Symbols LRG, HMFT1766
Peptide Sequence Synthetic peptide located within the following region: GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O'Donnell et al., 2002 [PubMed 12223515]).
Protein Interactions FN1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LRG1 (ARP52475_P050) antibody
Blocking Peptide For anti-LRG1 (ARP52475_P050) antibody is Catalog # AAP52475 (Previous Catalog # AAPP42935)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LRG1
Uniprot ID P02750
Protein Name Leucine-rich alpha-2-glycoprotein
Publications

O’Hanlon, T. P. et al. Plasma proteomic profiles from disease-discordant monozygotic twins suggest that molecular pathways are shared in multiple systemic autoimmune diseases. Arthritis Res. Ther. 13, R181 (2011). 22044644

Protein Accession # NP_443204
Purification Affinity Purified
Nucleotide Accession # NM_052972
Tested Species Reactivity Human
Gene Symbol LRG1
Predicted Species Reactivity Human, Cow, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Human: 100%; Pig: 79%
Image 1
Human Lung
WB Suggested Anti-LRG1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com