SNAG1 Antibody - N-terminal region (ARP52437_P050)

• Product Number: ARP52437_P050
• Name: SNAG1 Antibody - N-terminal region (ARP52437_P050)
• Protein Size (# AA): 628 amino acids
• Molecular Weight: 69kDa
• NCBI Gene Id: 112574
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Sorting nexin 18
• Alias Symbols: SNAG1, SH3PX2, SH3PXD3B
• Peptide Sequence: Synthetic peptide located within the following region: LLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQLYGGYQASQGSDDDWDD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like
• Protein Interactions: ANKRD28; GRB2; CBL; CUL1; FASLG; UBC; ITCH; SOS2; SOS1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SNX18 (ARP52437_P050) antibody is Catalog # AAP52437 (Previous Catalog # AAPP40805)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNAG1
• Uniprot ID: Q96RF0
• Protein Name: Sorting nexin-18
• Protein Accession #: NP_443102
• Purification: Affinity Purified
• Nucleotide Accession #: NM_052870
• Tested Species Reactivity: Human
• Gene Symbol: SNX18
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Yeast
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 88%; Dog: 80%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 93%; Yeast: 77%
• Image 1: Human 721_B
  
  WB Suggested Anti-SNAG1 Antibody Titration: 0.2-1 ug/ml
  Positive Control: 721_B cell lysate