CENTB5 Antibody - N-terminal region (ARP52414_P050)

Data Sheet
 
Product Number ARP52414_P050
Product Page www.avivasysbio.com/centb5-antibody-n-terminal-region-arp52414-p050.html
Name CENTB5 Antibody - N-terminal region (ARP52414_P050)
Protein Size (# AA) 759 amino acids
Molecular Weight 85kDa
NCBI Gene Id 116983
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name ArfGAP with coiled-coil, ankyrin repeat and PH domains 3
Alias Symbols CENTB5
Peptide Sequence Synthetic peptide located within the following region: LQSFVKEDVRKFKETKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
Description of Target CENTB5 is a GTPase-activating protein for the ADP ribosylation factor family.
Protein Interactions TAB1; SLC35G2; EIF6;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ACAP3 (ARP52414_P050) antibody
Blocking Peptide For anti-ACAP3 (ARP52414_P050) antibody is Catalog # AAP52414 (Previous Catalog # AAPS31701)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CENTB5
Uniprot ID Q96P50
Protein Name Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3
Protein Accession # NP_085152
Purification Affinity Purified
Nucleotide Accession # NM_030649
Tested Species Reactivity Human
Gene Symbol ACAP3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human Pancreas
WB Suggested Anti-CENTB5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Pancreas
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com