CENTB5 Antibody - N-terminal region (ARP52414_P050)

• Product Number: ARP52414_P050
• Name: CENTB5 Antibody - N-terminal region (ARP52414_P050)
• Protein Size (# AA): 759 amino acids
• Molecular Weight: 85kDa
• NCBI Gene Id: 116983
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: ArfGAP with coiled-coil, ankyrin repeat and PH domains 3
• Alias Symbols: CENTB5
• Peptide Sequence: Synthetic peptide located within the following region: LQSFVKEDVRKFKETKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
• Description of Target: CENTB5 is a GTPase-activating protein for the ADP ribosylation factor family.
• Protein Interactions: TAB1; SLC35G2; EIF6;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ACAP3 (ARP52414_P050) antibody is Catalog # AAP52414 (Previous Catalog # AAPS31701)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CENTB5
• Uniprot ID: Q96P50
• Protein Name: Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3
• Protein Accession #: NP_085152
• Purification: Affinity Purified
• Nucleotide Accession #: NM_030649
• Tested Species Reactivity: Human
• Gene Symbol: ACAP3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86%
• Image 1: Human Pancreas
  
  WB Suggested Anti-CENTB5 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human Pancreas