TRIB1 Antibody - middle region (ARP52412_P050)

• Product Number: ARP52412_P050
• Name: TRIB1 Antibody - middle region (ARP52412_P050)
• Protein Size (# AA): 372 amino acids
• Molecular Weight: 41 kDa
• NCBI Gene Id: 10221
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Tribbles homolog 1 (Drosophila)
• Alias Symbols: C8FW, GIG2, TRB1, GIG-2, SKIP1, TRB-1
• Peptide Sequence: Synthetic peptide located within the following region: TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kathiresan,S., (2008) Nat. Genet. 40 (2), 189-197
• Description of Target: TRIB1 interacts with MAPK kinases and regulates activation of MAP kinases. TRIB1 may not display kinase activity.
• Protein Interactions: RFWD2; MYC; ELAVL1; UBC; MAP2K7; MAP2K4; MAP2K1; ALOX12;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-TRIB1 (ARP52412_P050) antibody is Catalog # AAP52412 (Previous Catalog # AAPS31611)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIB1
• Uniprot ID: Q96RU8
• Protein Name: Tribbles homolog 1
• Sample Type Confirmation:

  TRIB1 is supported by BioGPS gene expression data to be expressed in COLO205

• Protein Accession #: NP_079471
• Purification: Affinity Purified
• Nucleotide Accession #: NM_025195
• Tested Species Reactivity: Human
• Gene Symbol: TRIB1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 77%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%
• Image 1: Human intestine, THP-1
  
  Host: Rabbit
  Target: TRIB1
  Positive control (+): Human intestine (IN)
  Negative control (-): THP-1 (N30)
  Antibody concentration: 1ug/ml
• Image 2: Human Lung Tissue
  
  Rabbit Anti-TRIB1 Antibody
  Catalog Number: ARP52412_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
  Observed Staining: Cytoplasmic in alveolar type I & II cells
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
  
• Image 3: Human Stomach Tumor
  
  Host: Rabbit
  Target Name: TRIB1
  Sample Tissue: Human Stomach Tumor
  Antibody Dilution: 1.0ug/ml