CRY2 Antibody - N-terminal region (ARP52398_P050)

Data Sheet
 
Product Number ARP52398_P050
Product Page www.avivasysbio.com/cry2-antibody-n-terminal-region-arp52398-p050.html
Name CRY2 Antibody - N-terminal region (ARP52398_P050)
Protein Size (# AA) 593 amino acids
Molecular Weight 67kDa
NCBI Gene Id 1408
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cryptochrome 2 (photolyase-like)
Alias Symbols HCRY2, PHLL2
Peptide Sequence Synthetic peptide located within the following region: IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target CRY2 is a blue light-dependent regulator of the circadian feedback loop.CRY2 inhibits CLOCK NPAS2-ARNTL E box-mediated transcription. CRY2 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity.CRY2 has no photolyase activity. CRY2 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus.CRY2 may inhibit CLOCK NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.
Protein Interactions MTUS2; PDE9A; CTBP1; UBC; FBXL3; FBXL21; BTRC; CUL1; SKP1; ATXN1; Csnk1e; PER3; PER2; PER1; PPP5C; TTC1; CRY2; TIMELESS;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CRY2 (ARP52398_P050) antibody
Blocking Peptide For anti-CRY2 (ARP52398_P050) antibody is Catalog # AAPP14342
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CRY2
Uniprot ID Q49AN0
Protein Name Cryptochrome-2
Publications

Deep-brain photoreception links luminance detection to motor output in Xenopus frog tadpoles. Proc. Natl. Acad. Sci. U.S.A. 113, 6053-8 (2016). 27166423

Protein Accession # NP_066940
Purification Affinity Purified
Nucleotide Accession # NM_021117
Tested Species Reactivity Human
Gene Symbol CRY2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Image 1
Human U937
WB Suggested Anti-CRY2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: U937 cell lysate
Image 2
Human Placenta, HepG2 Cell Lysate
Host: Rabbit
Target: CRY2
Positive control (+): Human Placenta (PL)
Negative control (-): HepG2 Cell Lysate (HG)
Antibody concentration: 1ug/ml
Image 3
Human RPMI 8226 Whole Cell
Host: Rabbit
Target Name: CRY2
Sample Tissue: Human RPMI 8226 Whole Cell
Antibody Dilution: 1ug/ml
Image 4
Human heart
Rabbit Anti-CRY2 Antibody
Catalog Number: ARP52398_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com