| Product Number |
ARP52390_P050 |
| Product Page |
www.avivasysbio.com/lefty1-antibody-n-terminal-region-arp52390-p050.html |
| Name |
LEFTY1 Antibody - N-terminal region (ARP52390_P050) |
| Protein Size (# AA) |
366 amino acids |
| Molecular Weight |
11kDa |
| NCBI Gene Id |
10637 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Left-right determination factor 1 |
| Alias Symbols |
LEFTB, LEFTYB |
| Peptide Sequence |
Synthetic peptide located within the following region: MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Dvash,T., (2007) Stem Cells 25 (2), 465-472 |
| Description of Target |
LEFTY1 is a member of the TGF-beta family of proteins. A similar secreted protein in mouse plays a role in left-right asymmetry determination of organ systems during development. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LEFTY1 (ARP52390_P050) antibody |
| Blocking Peptide |
For anti-LEFTY1 (ARP52390_P050) antibody is Catalog # AAP52390 (Previous Catalog # AAPP14334) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LEFTY1 |
| Uniprot ID |
O75610 |
| Protein Name |
Left-right determination factor 1 |
| Protein Accession # |
NP_066277 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_020997 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LEFTY1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-LEFTY1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T |
|
|
