PSORS1C1 Antibody - N-terminal region (ARP52340_P050)

Data Sheet
 
Product Number ARP52340_P050
Product Page www.avivasysbio.com/psors1c1-antibody-n-terminal-region-arp52340-p050.html
Name PSORS1C1 Antibody - N-terminal region (ARP52340_P050)
Protein Size (# AA) 152 amino acids
Molecular Weight 16kDa
NCBI Gene Id 170679
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Psoriasis susceptibility 1 candidate 1
Alias Symbols SEEK1, C6orf16
Peptide Sequence Synthetic peptide located within the following region: MTCTDQKSHSQRALGTQTPALQGPQLLNTDPSSEETRPPHVNPDRLCHME
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene is one of several genes thought to confer susceptibility to psoriasis and systemic sclerosis, located on chromosome 6 near the major histocompatibility complex (MHC) class I region.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-PSORS1C1 (ARP52340_P050) antibody
Blocking Peptide For anti-PSORS1C1 (ARP52340_P050) antibody is Catalog # AAP52340
Uniprot ID Q9UIG5
Protein Name Psoriasis susceptibility 1 candidate gene 1 protein
Protein Accession # NP_054787
Purification Affinity Purified
Nucleotide Accession # NM_014068
Tested Species Reactivity Human
Gene Symbol PSORS1C1
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 93%
Image 1
Western Blot
25 ug of the indicated whole cell extracts was loaded onto a 10-20% gradient SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended antibody dilution is 1 ug/mL to 3 ug/mL.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com