| Product Number |
ARP52307_P050 |
| Product Page |
www.avivasysbio.com/chp-antibody-n-terminal-region-arp52307-p050.html |
| Name |
CHP Antibody - N-terminal region (ARP52307_P050) |
| Protein Size (# AA) |
195 amino acids |
| Molecular Weight |
22kDa |
| NCBI Gene Id |
11261 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Calcium binding protein P22 |
| Alias Symbols |
CHP, p22, p24, SPAX9, Sid470p, SLC9A1BP |
| Peptide Sequence |
Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity. |
| Protein Interactions |
vpu; UBC; ELAVL1; SLC9A4; PRSS23; KIF1B; STK17B; SLC9A2; SLC9A5; SLC9A3; GAPDH; SLC9A1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CHP1 (ARP52307_P050) antibody |
| Blocking Peptide |
For anti-CHP1 (ARP52307_P050) antibody is Catalog # AAP52307 (Previous Catalog # AAPP43725) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CHP |
| Uniprot ID |
Q99653 |
| Protein Name |
Calcineurin B homologous protein 1 |
| Sample Type Confirmation |
CHP1 is supported by BioGPS gene expression data to be expressed in 721_B |
| Protein Accession # |
NP_009167 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007236 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CHP1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human Adult Liver
 | Rabbit Anti-CHP1 Antibody
Catalog Number: ARP52307_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Cytoplasm and Membrane, moderate signal, low tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|
| Image 2 | Human 721_B
 | WB Suggested Anti-CHP Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysateCHP1 is supported by BioGPS gene expression data to be expressed in 721_B |
|
