NUP50 Antibody - C-terminal region (ARP52288_P050)

Data Sheet
 
Product Number ARP52288_P050
Product Page www.avivasysbio.com/nup50-antibody-c-terminal-region-arp52288-p050.html
Name NUP50 Antibody - C-terminal region (ARP52288_P050)
Protein Size (# AA) 468 amino acids
Molecular Weight 50kDa
NCBI Gene Id 10762
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Nucleoporin 50kDa
Alias Symbols NPAP60, NPAP60L
Peptide Sequence Synthetic peptide located within the following region: TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Olsen,J.V., (2006) Cell 127 (3), 635-648
Description of Target The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. NUP50 is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import.The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene.
Protein Interactions KPNA5; KPNA4; KPNA3; KPNA2; KPNA1; KPNA6; UBC; KIAA1033; SART3; TTI1; TSC22D1; IKBKAP; KIF5B; EPB41L1; ACACA; SRPK2; LMNA; HDAC6; NPM1; UBAP2; TOR1AIP1; NUP153; APP; CUL3; Mki67; Kifc5b; SLX4; KPNB1; XPO1; RAN; CDKN1B; IPO13;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NUP50 (ARP52288_P050) antibody
Blocking Peptide For anti-NUP50 (ARP52288_P050) antibody is Catalog # AAP52288 (Previous Catalog # AAPS30802)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NUP50
Uniprot ID Q9UKX7
Protein Name Nuclear pore complex protein Nup50
Sample Type Confirmation

There is BioGPS gene expression data showing that NUP50 is expressed in HepG2

NUP50 is supported by BioGPS gene expression data to be expressed in HeLa

Protein Accession # NP_009103
Purification Affinity Purified
Nucleotide Accession # NM_007172
Tested Species Reactivity Human
Gene Symbol NUP50
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast
Application IF, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 91%; Pig: 100%; Rabbit: 100%; Rat: 92%; Yeast: 80%
Image 1
Human HepG2
WB Suggested Anti-NUP50 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that NUP50 is expressed in HepG2
Image 2
Human HepG2
Host: Rabbit
Target Name: NUP50
Sample Type: HepG2
Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that NUP50 is expressed in HepG2
Image 3
Human Hela
Host: Rabbit
Target Name: NUP50
Sample Type: Hela
Antibody Dilution: 1.0ug/mlNUP50 is supported by BioGPS gene expression data to be expressed in HeLa
Image 4
Human HeLa
Sample Type : Hela cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com