Product Number |
ARP52268_P050 |
Product Page |
www.avivasysbio.com/rab35-antibody-middle-region-arp52268-p050.html |
Name |
RAB35 Antibody - middle region (ARP52268_P050) |
Protein Size (# AA) |
201 amino acids |
Molecular Weight |
23kDa |
NCBI Gene Id |
11021 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
RAB35, member RAS oncogene family |
Alias Symbols |
RAY, H-ray, RAB1C |
Peptide Sequence |
Synthetic peptide located within the following region: GIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
RAB35 possesses GTPase activity. |
Protein Interactions |
UBC; RPA3; RPA2; RPA1; AMOT; LATS1; Ccdc64b; IQCB1; UBL4A; FN1; ATP6V1B1; APP; ATG16L1; ALK; TBPL1; C2orf44; CBR3; IDH3B; GNPAT; PTPRS; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RAB35 (ARP52268_P050) antibody |
Blocking Peptide |
For anti-RAB35 (ARP52268_P050) antibody is Catalog # AAP52268 (Previous Catalog # AAPP44029) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RAB35 |
Uniprot ID |
Q15286 |
Protein Name |
Ras-related protein Rab-35 |
Protein Accession # |
NP_006852 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006861 |
Tested Species Reactivity |
Human |
Gene Symbol |
RAB35 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 79% |
Image 1 | Human
| RAB35 antibody - middle region (ARP52268_P050) validated by WB using HeLa cells, HEK293T cells at 1:500. |
| Image 2 | Human heart
| WB Suggested Anti-RAB35 Antibody Titration: 0.2-1 ug/ml Positive Control: Human heart |
|
|