RAB35 Antibody - middle region (ARP52268_P050)

Data Sheet
 
Product Number ARP52268_P050
Product Page www.avivasysbio.com/rab35-antibody-middle-region-arp52268-p050.html
Name RAB35 Antibody - middle region (ARP52268_P050)
Protein Size (# AA) 201 amino acids
Molecular Weight 23kDa
NCBI Gene Id 11021
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name RAB35, member RAS oncogene family
Alias Symbols RAY, H-ray, RAB1C
Peptide Sequence Synthetic peptide located within the following region: GIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target RAB35 possesses GTPase activity.
Protein Interactions UBC; RPA3; RPA2; RPA1; AMOT; LATS1; Ccdc64b; IQCB1; UBL4A; FN1; ATP6V1B1; APP; ATG16L1; ALK; TBPL1; C2orf44; CBR3; IDH3B; GNPAT; PTPRS;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RAB35 (ARP52268_P050) antibody
Blocking Peptide For anti-RAB35 (ARP52268_P050) antibody is Catalog # AAP52268 (Previous Catalog # AAPP44029)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RAB35
Uniprot ID Q15286
Protein Name Ras-related protein Rab-35
Protein Accession # NP_006852
Purification Affinity Purified
Nucleotide Accession # NM_006861
Tested Species Reactivity Human
Gene Symbol RAB35
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 79%
Image 1
Human
RAB35 antibody - middle region (ARP52268_P050) validated by WB using HeLa cells, HEK293T cells at 1:500.
Image 2
Human heart
WB Suggested Anti-RAB35 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com