| Product Number |
ARP52267_P050 |
| Product Page |
www.avivasysbio.com/rab35-antibody-middle-region-arp52267-p050.html |
| Name |
RAB35 Antibody - middle region (ARP52267_P050) |
| Protein Size (# AA) |
201 amino acids |
| Molecular Weight |
23kDa |
| NCBI Gene Id |
11021 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
RAB35, member RAS oncogene family |
| Alias Symbols |
RAY, H-ray, RAB1C |
| Peptide Sequence |
Synthetic peptide located within the following region: RTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
RAB35 possesses GTPase activity. |
| Protein Interactions |
UBC; RPA3; RPA2; RPA1; AMOT; LATS1; Ccdc64b; IQCB1; UBL4A; FN1; ATP6V1B1; APP; ATG16L1; ALK; TBPL1; C2orf44; CBR3; IDH3B; GNPAT; PTPRS; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RAB35 (ARP52267_P050) antibody |
| Blocking Peptide |
For anti-RAB35 (ARP52267_P050) antibody is Catalog # AAP52267 (Previous Catalog # AAPP44028) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RAB35 |
| Uniprot ID |
Q15286 |
| Protein Name |
Ras-related protein Rab-35 |
| Publications |
Kley, R. A. et al. A combined laser microdissection and mass spectrometry approach reveals new disease relevant proteins accumulating in aggregates of filaminopathy patients. Mol. Cell. Proteomics 12, 215-27 (2013). 23115302 |
| Protein Accession # |
NP_006852 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006861 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RAB35 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Liver
 | WB Suggested Anti-RAB35 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver |
|
| Image 2 | Human MCF7 Whole Cell
 | Host: Rabbit
Target Name: RAB35
Sample Tissue: Human MCF7 Whole Cell
Antibody Dilution: 3ug/ml |
|
