FGL2 Antibody - middle region (ARP52235_P050)

• Product Number: ARP52235_P050
• Name: FGL2 Antibody - middle region (ARP52235_P050)
• Protein Size (# AA): 439 amino acids
• Molecular Weight: 50 kDa
• NCBI Gene Id: 10875
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Fibrinogen-like 2
• Alias Symbols: T49, pT49
• Peptide Sequence: Synthetic peptide located within the following region: WTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-FGL2 (ARP52235_P050) antibody is Catalog # AAP52235 (Previous Catalog # AAPP42443)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FGL2
• Uniprot ID: Q14314
• Protein Name: Fibroleukin
• Publications:

  Complement factor 5 blockade reduces porcine myocardial infarction size and improves immediate cardiac function. Basic Res. Cardiol. 112, 20 (2017). 28258298

  Transgenic Expression of Human Thrombomodulin Inhibits HMGB1-Induced Porcine Aortic Endothelial Cell Activation. Transplantation. 100, 1871-9 (2016). 27077599

• Protein Accession #: NP_006673
• Purification: Affinity Purified
• Nucleotide Accession #: NM_006682
• Tested Species Reactivity: Human
• Gene Symbol: FGL2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
• Image 1: Human Placenta
  
  WB Suggested Anti-FGL2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human Placenta
• Image 2:
  
  25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Protein may be subject to glycosylation.