| Product Number |
ARP52218_P050 |
| Product Page |
www.avivasysbio.com/hsph1-antibody-c-terminal-region-arp52218-p050.html |
| Name |
Hsph1 Antibody - C-terminal region (ARP52218_P050) |
| Protein Size (# AA) |
858 amino acids |
| Molecular Weight |
94kDa |
| NCBI Gene Id |
288444 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Heat shock 105/110 protein 1 |
| Alias Symbols |
Hsp105 |
| Peptide Sequence |
Synthetic peptide located within the following region: VVTQPKPKIESPKLERTPNGPNMDKKEDLEGKSNLGADAPHQNGECHPNE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Hsph1 prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. It inhibits HSPA8/HSC70 ATPase and chaperone activities. |
| Protein Interactions |
Ubc; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Hsph1 (ARP52218_P050) antibody |
| Blocking Peptide |
For anti-Hsph1 (ARP52218_P050) antibody is Catalog # AAP52218 |
| Uniprot ID |
Q66HA8 |
| Protein Name |
Heat shock protein 105 kDa |
| Protein Accession # |
NP_001011901 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001011901 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Hsph1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
| Image 1 | Rat Brain
 | WB Suggested Anti-Hsph1 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Brain |
|
|
